LL37/154947-66-7/LL37 Antimicrobial Peptide/LL37 Immunomodulatory Peptide
- Product Description
PeptideName:LL37/154947-66-7/LL37 Antimicrobial Peptide/LL37 Immunomodulatory Peptide
Catalog No:GT-M058
Sequence:[LL-37, 37 aa]
CAS Number:154947-66-7
Molecular Formula:C205H340N60O53
Molecular Weight:4493.74
Category:LL37,154947-66-7,Peptide synthesis,Peptide raw material company
Description:LL37 boasts broad-spectrum antibacterial activity, exerting inhibitory effects on Gram-positive bacteria, Gram-negative bacteria, fungi and viruses. Its unique amphipathic α-helical structure enables it to function by damaging the cell membranes of pathogens or interfering with intracellular metabolic pathways.

Specifications
Apperance: White to off-white powder
Purity(HPLC): ≥98.0%
Single Impurity: ≤2.0%
Acetate Content(HPLC): 5.0%~12.0%
Water Content (Karl Fischer): ≤10.0%
Peptide Content: ≥80.0%
Packing and Shipping: Low temperature, vacuum packing, accurate to mg as required.
FAQ:
Which modified labeled polypeptides can be synthesized in Chinese peptide?
Our company provides a variety of modified peptide labeling, such as acetylation, biotin labeling, phosphorylation modification, fluorescence modification, can also be customized according to your special needs.
What problems should be paid attention to in the storage process?
The peptide you received was packaged in lyophilized powder. Peptides are hydrophilic, and absorption of water will reduce the stability of the peptide and reduce the peptide content. Please pay attention to the following: first, with desiccants, stored in a dry environment. Second, once received, please immediately put into the freezer -20℃ storage, in order to maintain maximum stability. Third, avoid the use of no automatic frost function of the freezer. Changes in humidity and temperature can affect the stability of peptides. Fourth, the external temperature during transportation does not affect the validity and quality of peptides.
How is my peptide transported? What test reports are provided?
All freeze-dried polypeptides are usually stored in special containers of 2 ml or 10ml with original analytical data and synthesis reports containing important information such as sequence, molecular weight, purity, weight, and number of the polypeptide.
If a LL37 is 98% pure, what is 2%?
Two percent of the composition was truncated or deleted sequence fragments.
Is it necessary to put a gap between the peptide and the dye?
If you are going to attach a large molecule (such as a dye) to the peptide, it is best to put a space between the peptide and the ligand to minimize interference with the receptor by the folding of the peptide itself or by the folding of its conjugate. Others do not want intervals. For example, in the folding of proteins, it is possible to determine how far apart the folding structure of an amino acid is by attaching a fluorescent dye to a particular site.






